PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011099453.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GeBP
Protein Properties Length: 362aa    MW: 40295.5 Da    PI: 5.1645
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011099453.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573122.12.7e-38172267297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     lfqrlwse+Deiv+LqG+id+ +k++++p +d++af++f+kk+++++++++ql +Kir+L++K++++++k k+gk+ +fsk+h+q+++elskkiW
  XP_011099453.1 172 LFQRLWSEDDEIVILQGMIDYVTKKKSDPAADLNAFHDFIKKNLHVDATRTQLQDKIRSLRRKYENNKSKEKEGKDRTFSKPHEQQAYELSKKIW 266
                     69********************************************************************************************* PP

          DUF573  97 g 97 
                     g
  XP_011099453.1 267 G 267
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.4E-35173267IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MAKNREPEKP VESETESGEE EDEVATSEDV GSQDSDSEPD LAQVSKKPSS STQATPKKAQ  60
PQSSSKPQPQ PPSSSDEEES GSESESDSDE PDPNVKPIAS KPMENEQKSS DGARKLRSKP  120
IASDLVTPAK STAAKRPAEE KEPETKDAKK SKKKAEPDTY AKKSTDDSKK LLFQRLWSED  180
DEIVILQGMI DYVTKKKSDP AADLNAFHDF IKKNLHVDAT RTQLQDKIRS LRRKYENNKS  240
KEKEGKDRTF SKPHEQQAYE LSKKIWGNES GKENGVENEE AKVVNSDPES LLPAKRVNSG  300
GVTVEERILR IGAEYFESGK GLEGEKEWKK LRVEEIEVYL RQLEVKTARA KLALDAVKSG  360
GH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099453.10.0PREDICTED: mediator-associated protein 1-like
STRINGPGSC0003DMT4000792159e-61(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30421947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.13e-30DNA-binding storekeeper protein-related transcriptional regulator